T1061 Domain 6 Parse 1 Confidence: 0.31
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 29815 | Complete | Structure prediction | casp | T1061 | 949 | 19 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 29312 | 6 | 1 | 0.31 | comparative modeling | 624-670 | 47 | 20 Jun 2020 |
>29312
KGLDKKLQLSFANITNYYTARSYADRELKKSRYSRTLSFSVPYKFIG
>3n7nE_301 weight: 1.0000 score: 7.5 eval: n/a prob: n/a identity: 0.1277 startpos: 1
--------TLLQLLSNYYKAKLDSERIYNEYVQSQYEFA--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington