T1083 Domain 1 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 32296 | Complete | Structure prediction | casp | T1083 | 98 | 13 Jul 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 31171 | 1 | 1 | 0.07 | comparative modeling | 1-98 | 98 | 13 Jul 2020 |
>31171
GAMGSEIEHIEEAIANAKTKADHERLVAHYEEEAKRLEKKSEEYQELAKVYKKITDVYPNIRSYMVLHYQNLTRRYKEAAEENRALAKLHHELAIVED
>3u8vA_305 weight: 1.0000 score: 5.68 eval: n/a prob: n/a identity: 0.1224 startpos: 1
----------------SGHTAHVDEAVKHAEEAVAHGKehTDQLLEHAKESLTHAKAASTHVGHGIKHLEDAIKHGEehVGVATKHAQEAIEHLRAS-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington