T1099 Domain 2 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 33710 | Complete | Structure prediction | casp | T1099 | 262 | 30 Jul 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 32824 | 2 | 1 | 0.33 | comparative modeling | 199-262 | 64 | 30 Jul 2020 |
>32824
GRKTTTGTRKPRGLEPRRRKVKTTVVYGRRRSKSRERRAPTPQRAGSPLPRSSSSHHRSPSPRK
>6lntD_201 weight: 1.0000 score: 20.85 eval: 460 prob: 15.34 identity: 0.2188 startpos: 52
-----DEGVEPDDVDCWCNTTSTWVVYGTCHHkrRSRRAVTLPssTRKLQTRS-----------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington