T0972 Domain 1 Parse 1 Confidence: 0.01
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 245 | Complete | Structure prediction | casp | T0972 | 106 | 24 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 378 | 1 | 1 | 0.01 | comparative modeling | 1-106 | 106 | 24 May 2018 |
>378
MVVDNTQKTSNAIFSTTTKVKEKNTSADEFQATLNEVKNKEEKEDKKTNSSKFTNEDIDLGAVREDFRSYAWQKMREDQYKKNEETLLNKLFTTIDAGNATNNTKA
>m0cxA_201 weight: 1.0000 score: 19.82 eval: 480 prob: 12.67 identity: 0.0755 startpos: 12
-------GdaPTFSNLyeILDPL-LGEQEFRTIITKINQELINAFDP------YAARNWFDGIMGFLTGWVWDDLGASRIKSRIKGL----EAWIDKWNR------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington