T0956_skip_domain_parser Domain 1 Parse 1 Confidence: 0.03
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
250 | Complete | Structure prediction | casp | T0956_skip_domain_parser | 178 | 25 May 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
383 | 1 | 1 | 0.03 | comparative modeling | 1-178 | 178 | 25 May 2018 |
>383
SATMAFHPMLCRLELSVSAAPPASPIDATLLRSLITSVLNSSWVDLGGNTANEKVLCAIGLIEAFCRERVIPPTSNSFNTSVTYHIMVEDLDPDDLGNIQLINKPLLSLEGDLKVLGSYQLTFQTIPGHSEPRSMTDNGIYHSDSPFFQIALGHALLGTGKIYDHITRALRVAPITIA
>3m20A_201 weight: 1.0000 score: 17.52 eval: 200 prob: 36.15 identity: 0.0281 startpos: 3
-----------------------------------------LIVYGPKLDVGKKREFVERLTSVAAEIYGMDRS----A----ITILIHEPPAENVGVGGKL----------------------------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington