2022-07-30_00000299_1_11 Domain 3 Parse 1 Confidence: 0.32
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
385930 | Error | Structure prediction | cameo | 2022-07-30_00000299_1_11 | 2092 | 30 Jul 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
389119 | 3 | 1 | 0.32 | comparative modeling | 1226-1284 | 59 | 12 Aug 2022 |
>389119
DRTFGNHRSILAWTIEHLVKKNKINALDALPLITFENDWHKCDLLDSVLSSCTDDKDKI
>3b6hA_101 weight: 0.9584 score: 33.61 eval: 0.014 prob: n/a identity: 0.0678 startpos: 248
------EEMQARALVLQLWATqnMGPAAFWLLLFLL---KNPEALAAVRGEL-------
>4y8wC_102 weight: 0.0416 score: 33.17 eval: 0.015 prob: n/a identity: 0.0169 startpos: 243
------EGHVHMAAVDLLIGGttTANTLSWAVVFLLH---HPEIQQRLQEEL-------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington