2022-10-15_00000059_1_19 Domain 2 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 428111 | Complete | Structure prediction | RoseTTAFold | 2022-10-15_00000059_1_19 | 1285 | 15 Oct 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 423663 | 2 | 1 | 0.33 | comparative modeling | 119-204 | 86 | 16 Oct 2022 |
>423663
SKVSRSHLYMEEMRKRARLMKRSFSNFKTYLIPWESKIKRIESHFGSVVSSYFTFLRWIVFVNIMITLIALVFVVLPETLADSVAN
>5figB_w003 weight: 0.5008 score: 0.03844 eval: n/a prob: n/a identity: 0.0349 startpos: 15
--MKACNHCFTKCLEHLSGCIRLDRECADICALAVKAMQTDSPFMKEICALCADICEACGCGKHHCQACAKACFTCAEQCR-----
>5figA_w003 weight: 0.4992 score: 0.03717 eval: n/a prob: n/a identity: 0.0349 startpos: 13
--MKACNHCFTKCLEHLSGCIRLDRECADICALAVKAMQTDSPFMKEICALCADICEACGCGKHHCQACAKACFTCAEQCR-----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington