2022-10-15_00000059_1_19 Domain 8 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 428111 | Complete | Structure prediction | RoseTTAFold | 2022-10-15_00000059_1_19 | 1285 | 15 Oct 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 423669 | 8 | 1 | 0.07 | comparative modeling | 1100-1285 | 186 | 16 Oct 2022 |
>423669
YEHTRDDHKNFVASTIKETDEDPGKSDKKQTSSKDVAPDFMPWPSADEARALREKMKSKTPLMLTKTTVEEKPKGGKSSESEFRPPVPIHRKYNIQTTEEENEEEETDSAPESSKKRFRISVSPTKTIAPASASRAQHKIVSQASSSSSIPHGRQPDPNKKASLVLPPLRAPRVQFDEDDSPRQID
>2nbqA_101 weight: 1.0000 score: 16.42 eval: 0.059 prob: n/a identity: 0.0269 startpos: 170
--------------------------------------PFQPWDGLehSQALSGRLRA--------------------------------------------------------------------------------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington