2022-11-12_00000184_1_19 Domain 1 Parse 1 Confidence: 0.37
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
449219 | Error | Structure prediction | RoseTTAFold | 2022-11-12_00000184_1_19 | 2004 | 12 Nov 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
444644 | 1 | 1 | 0.37 | comparative modeling | 1-93 | 93 | 13 Nov 2022 |
>444644
MVWSHPQFEKGGGSGGGSGGSAWSHPQFEKGDYPYDVPDYAGTENLYFQGLVDMKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDN
>7d9rB_101 weight: 0.9631 score: 15.2 eval: 0.0065 prob: n/a identity: 0.0645 startpos: 283
-------------------------------------------DSILFLCSPSVM--NLDDLTRRGLYLS-----------------------
>6jt2B_103 weight: 0.0369 score: 14.77 eval: 0.0081 prob: n/a identity: 0.0645 startpos: 283
-------------------------------------------DSILFLCSPSVM--NLDDLTRRGLYLS-----------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington