2022-11-19_00000158_1_19 Domain 4 Parse 1 Confidence: 0.36
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 450091 | Complete | Structure prediction | RoseTTAFold | 2022-11-19_00000158_1_19 | 2201 | 19 Nov 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 445515 | 4 | 1 | 0.36 | comparative modeling | 489-574 | 86 | 20 Nov 2022 |
>445515
KPEKIEAPKEYTGVQAGAVVEPAKAEAPKEYRGVQAGAIVEPEKIESPKEYTGVQAGAVVEPAKAEVPKEYRGVQAGAIVEPEKIE
>7mj5A_201 weight: 1.0000 score: 14.25 eval: n/a prob: 5.13 identity: 0.0814 startpos: 1
--AEVAQPKLYQRGEGGNGMEPIPEDVLNEA-------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington