2022-11-19_00000158_1_11 Domain 5 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 450090 | Complete | Structure prediction | cameo | 2022-11-19_00000158_1_11 | 2201 | 19 Nov 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 445525 | 5 | 1 | 0.33 | comparative modeling | 571-693 | 123 | 20 Nov 2022 |
>445525
EKIESPKEYTGEQSGAIVEPEKVETTKEYTGIQAGALVEPEKVEAPKEYTGVQAGAIVEPEKVEPPKEYTGVQAGAIVEPEKVEAPKEYTGKIEPLKTENPKPTVENNNTAEINNVPKNASAL
>3be7A_101 weight: 1.0000 score: 8.432 eval: 0.004 prob: n/a identity: 0.0407 startpos: 10
---------------GYLDIQTGEIIKADLLIRNGKIAEI-----------------------------------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington