2021-01-02_00000089_1_11 Domain 3 Parse 1 Confidence: 0.19
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
50547 | Complete | Structure prediction | cameo | 2021-01-02_00000089_1_11 | 1612 | 2 Jan 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
49417 | 3 | 1 | 0.19 | comparative modeling | 1542-1612 | 71 | 3 Jan 2021 |
>49417
SPVTTTNNLPRRSMASARGNKLRTSLDRTREEMLANHQLDTRYSVERARASLDLPGINHAETLLSQRSRDR
>6dmaD_301 weight: 1.0000 score: 7.43 eval: n/a prob: n/a identity: 0.0563 startpos: 1
------KLLERSRRLQEESKRLLDEMAEIMRRIKKLLKKEKVLDELRKIIERIRELLDRSRKIHERSEEIA
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington