2023-05-13_00000202_2_19 Domain 1 Parse 1 Confidence: 0.74
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
517278 | Complete | Structure prediction | RoseTTAFold | 2023-05-13_00000202_2_19 | 1905 | 13 May 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
512342 | 1 | 1 | 0.74 | comparative modeling | 21-72 | 52 | 14 May 2023 |
>512342
SSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCS
>7v28D_w001 weight: 0.3545 score: 0.01107 eval: n/a prob: n/a identity: 0.0192 startpos: 40
---DGTPVKDLVVFRDSEGRVGVMDEYCPSLNEEGGLRCWKMDVDGDKVKH-
>7v28F_w001 weight: 0.3337 score: 0.00962 eval: n/a prob: n/a identity: 0.0192 startpos: 40
---DGTPVKDLVVFRDSEGRVGVMDEYCPSLNEEGGLRCWKMDVDGDKVKH-
>7v25D_w001 weight: 0.3119 score: 0.01107 eval: n/a prob: n/a identity: 0.0192 startpos: 40
---DGTPVKDLVVFRDSEGRVGVMDEYRASLNEEGGLRCWKMDVDGDKVKH-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington