2023-05-13_00000202_2_11 Domain 1 Parse 1 Confidence: 0.74
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 517273 | Complete | Structure prediction | cameo | 2023-05-13_00000202_2_11 | 1905 | 13 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 512350 | 1 | 1 | 0.74 | comparative modeling | 21-72 | 52 | 14 May 2023 |
>512350
SSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCS
>7v28D_w001 weight: 0.3545 score: 0.01107 eval: n/a prob: n/a identity: 0.0192 startpos: 40
---DGTPVKDLVVFRDSEGRVGVMDEYCPSLNEEGGLRCWKMDVDGDKVKH-
>7v28F_w001 weight: 0.3337 score: 0.00962 eval: n/a prob: n/a identity: 0.0192 startpos: 40
---DGTPVKDLVVFRDSEGRVGVMDEYCPSLNEEGGLRCWKMDVDGDKVKH-
>7v25D_w001 weight: 0.3119 score: 0.01107 eval: n/a prob: n/a identity: 0.0192 startpos: 40
---DGTPVKDLVVFRDSEGRVGVMDEYRASLNEEGGLRCWKMDVDGDKVKH-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington