2023-05-13_00000202_1_19 Domain 2 Parse 1 Confidence: 0.67
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 517265 | Complete | Structure prediction | RoseTTAFold | 2023-05-13_00000202_1_19 | 2068 | 13 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 514329 | 2 | 1 | 0.67 | comparative modeling | 164-244 | 81 | 19 May 2023 |
>514329
VPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGS
>7rd1A_w076 weight: 1.0000 score: 0.99139 eval: n/a prob: n/a identity: 0.0247 startpos: 7
-------PVTLAVS--FKPSSQWEQDTMEHTFGVE--NI------TGLALKMKP-CGGQAARYLPSYSAANLKTKVYSGA-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington