2023-05-13_00000202_1_19 Domain 11 Parse 1 Confidence: 0.62
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 517265 | Complete | Structure prediction | RoseTTAFold | 2023-05-13_00000202_1_19 | 2068 | 13 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 514338 | 11 | 1 | 0.62 | comparative modeling | 1329-1388 | 60 | 19 May 2023 |
>514338
PPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTL
>7rd1A_w021 weight: 1.0000 score: 0.24522 eval: n/a prob: n/a identity: 0.0500 startpos: 5
-FVPVTLVSFPSSQTFGVENITGLQIA-LKMKPQAYLPDPGSYSAANLKTKVYS------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington