2023-07-29_00000214_1_19 Domain 2 Parse 1 Confidence: 0.49
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 538838 | Complete | Structure prediction | RoseTTAFold | 2023-07-29_00000214_1_19 | 1326 | 29 Jul 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 533740 | 2 | 1 | 0.49 | comparative modeling | 1258-1326 | 69 | 29 Jul 2023 |
>533740
SIAPNLTLNLHTINATFLDLLIKRMKQIEDKIEEIESKQKKIENEIARIKKIKLVPRGSLEWSHPQFEK
>6n7mA_302 weight: 1.0000 score: 6.15 eval: n/a prob: n/a identity: 0.1594 startpos: 1
-----------GVEHYTYEEYAKHIQELKDYakDLEETIKKMEQELEKIKTEG------LKIMKPITIE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington