2023-10-28_00000189_1_11 Domain 2 Parse 1 Confidence: 0.03
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 558326 | Complete | Structure prediction | cameo | 2023-10-28_00000189_1_11 | 1331 | 28 Oct 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 553125 | 2 | 1 | 0.03 | comparative modeling | 785-928 | 144 | 28 Oct 2023 |
>553125
LKGSITINLSSIKVVKLFRLLRGLRMLRLTKALIPKLILVVNGKINNQLSLGYDVGKGYIIGEEEVGKIIDRMVDNKKILRELKHISETGRLQVVKELGLLQREHPGIAVSVKTRQAIRTILNHSRETIHELQGAGLLDEMEAH
>4utqA_w005 weight: 1.0000 score: 0.06897 eval: n/a prob: n/a identity: 0.0764 startpos: 3
-------------------LLVIALLFVSFMIWQAWGNWGFSIIIITFIVRGIMYPPLGGCFPLLIQMPIFLALYYMYILPILMGVTMFFIQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIY------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington