2024-03-16_00000126_1_19 Domain 1 Parse 1 Confidence: 0.28
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 602979 | Error | Structure prediction | RoseTTAFold | 2024-03-16_00000126_1_19 | 2818 | 16 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 597441 | 1 | 1 | 0.28 | comparative modeling | 1-58 | 58 | 17 Mar 2024 |
>597441
MSFHITPTAAARDSETKQIDHNDSIRASYMTIEELHDAGAALSRDGADSLPGFMEFDF
>6w09Q_301 weight: 1.0000 score: 7.73 eval: n/a prob: n/a identity: 0.0690 startpos: 1
-PVMCLLANTtqPPCTPCCYEKEPEKTLRMLEDNVmgYYQLLQASLTCSPRRQRR---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington