2024-03-23_00000227_1_11 Domain 1 Parse 1 Confidence: 0.24
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 606166 | Complete | Structure prediction | cameo | 2024-03-23_00000227_1_11 | 1203 | 23 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 600717 | 1 | 1 | 0.24 | comparative modeling | 1-82 | 82 | 24 Mar 2024 |
>600717
MPKSGAHQPLVRHDTDDGGETGQSVKSLADVSEEEIDSRMSRRSSVIADLLSLFRRSSSVLVRPHTRLGNPNFDDDDDEFDE
>3j1oK_301 weight: 1.0000 score: 6.66 eval: n/a prob: n/a identity: 0.0976 startpos: 7
LEQTRTILSVKLAELINMTTISE--LAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLFDEKQIEELLDNCIETFVAE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington