2021-03-20_00000113_2_11 Domain 4 Parse 1 Confidence: 0.53
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
63881 | Complete | Structure prediction | cameo | 2021-03-20_00000113_2_11 | 1218 | 20 Mar 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
62256 | 4 | 1 | 0.53 | comparative modeling | 928-1005 | 78 | 20 Mar 2021 |
>62256
LQEGKVDSSLFHVAHFQDHGMVLETPARVEPHFAVLENPSFSPMGVLLRMIPAVGHFIPITSITLIYYRLYLEDITFH
>3db7A_303 weight: 1.0000 score: 5.22 eval: n/a prob: n/a identity: 0.0769 startpos: 33
AKMESDFLYKSYEVIFTN-GNKVEFDKKGNWEEVDCKHTSVPVAIiiQKYVTTNYPDAKVLKIErdYEVKLSNRTELK
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington