2024-07-27_00000166_1_19 Domain 1 Parse 1 Confidence: 0.15
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 626924 | Complete | Structure prediction | RoseTTAFold | 2024-07-27_00000166_1_19 | 1241 | 27 Jul 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 622740 | 1 | 1 | 0.15 | comparative modeling | 1-64 | 64 | 16 Aug 2024 |
>622740
MANGVIPPPGGASPLPQVRVPLEEPPLSPDVEEEDDDLGKTLAVSRFGDLISKPPAWDPEKPSR
>2muxA_201 weight: 1.0000 score: 19.76 eval: 980 prob: 23.09 identity: 0.1094 startpos: 67
----TTYYQTALPGnrYISVGSQADTniDLTGDDKDDLQRAIALSLAE---SNRAFRET-----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington