2021-05-01_00000159_1_11 Domain 1 Parse 1 Confidence: 0.21
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 73478 | Complete | Structure prediction | cameo | 2021-05-01_00000159_1_11 | 1380 | 1 May 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 71535 | 1 | 1 | 0.21 | comparative modeling | 1-108 | 108 | 2 May 2021 |
>71535
MGGEGLRASPRRRPLLPLQPRGCPRGDGCLRGGRGRAGFGFWRVTGGSSASANHVHAFFFFLQLLGNVLVVVLSHHFGKELRPSQAEFGTATMFVFLVLLPLVSSQCV
>5wivA_201 weight: 1.0000 score: 18.95 eval: 990 prob: 20.84 identity: 0.1481 startpos: 1
----------------------------------------------GQGAAALVGGVLLIGAVLAGNSLVCVSVAT-ERALQTPTNSfaAADLLLALLVLPLFVYS--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington