2021-05-08_00000123_1_11 Domain 1 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 74872 | Complete | Structure prediction | cameo | 2021-05-08_00000123_1_11 | 1519 | 8 May 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 73169 | 1 | 1 | 0.33 | comparative modeling | 1-88 | 88 | 11 May 2021 |
>73169
ADELSTMSEPTITNHAQQQAQHLTNTELSSAESKSQDTSQITPKTNREKEQSQDLVSEPTTTELADTDAASMANTGPDATQKSASLPP
>5f0oE_201 weight: 1.0000 score: 11.01 eval: n/a prob: 1.61 identity: 0.0227 startpos: 2
--------------QYL-LQDAVTEREVLLV---------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington