SSGCID - MymyA.20350.a Uncharacterized protein Domain 1 Parse 1 Confidence: 0.49
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
4980 | Complete | Structure prediction | ssgcid | SSGCID - MymyA.20350.a Un... | 100 | 7 Jun 2019 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
10919 | 1 | 1 | 0.49 | comparative modeling | 1-100 | 100 | 10 Nov 2019 |
>10919
MYIDIEKNSKGNLKIESKVINRLVENVILSMTKISDPKNVSSSIYVLDENQLHILATIKIGDEKLQDLNINEDKIFKAIDKTINQTISMKPKNINISYIR
>2mq8A_104 weight: 1.0000 score: 56.23 eval: 0.006 prob: n/a identity: 0.1300 startpos: 1
-MLTVEVEV--KITADdnKAEEIVKRVIDEVEREvqYPNATITRTLTRdgTVELRIKVKADTE------EKAKSIIKLIEERIEEELRKRDPNATITRTV
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington