2021-10-23_00000164_1_19 Domain 2 Parse 1 Confidence: 0.34
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
142573 | Complete | Structure prediction | RoseTTAFold | 2021-10-23_00000164_1_19 | 1352 | 23 Oct 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
138902 | 2 | 1 | 0.34 | comparative modeling | 1004-1044 | 41 | 23 Oct 2021 |
>138902
AYSVDARGQKSQLEHEFYELQPLASHSCTSSEKTTYEEPHT
>6rimD_101 weight: 0.9626 score: 12.96 eval: 0.012 prob: n/a identity: 0.0976 startpos: 34
RIQMSAYDGEGRIEYRNLKLYEISS----------------
>6rimF_102 weight: 0.0374 score: 12.15 eval: 0.017 prob: n/a identity: 0.0976 startpos: 34
RIQMSAYdgEGRIEYRNLKLYEISS----------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington