2021-11-13_00000175_1_19 Domain 4 Parse 1 Confidence: 0.28
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 150144 | Error | Structure prediction | RoseTTAFold | 2021-11-13_00000175_1_19 | 2839 | 13 Nov 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 147755 | 4 | 1 | 0.28 | comparative modeling | 423-479 | 57 | 17 Nov 2021 |
>147755
LDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKE
>3kflA_201 weight: 1.0000 score: 22.18 eval: 370 prob: 21.5 identity: 0.1404 startpos: 267
LNRWP-AD-VHVVGKDILKFHAIYWPAFLMSAELPLPERLVswWTkhKKISKSLGN-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington