2021-11-13_00000175_1_19 Domain 13 Parse 1 Confidence: 0.10
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
150144 | Error | Structure prediction | RoseTTAFold | 2021-11-13_00000175_1_19 | 2839 | 13 Nov 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
147764 | 13 | 1 | 0.10 | comparative modeling | 1861-1940 | 80 | 17 Nov 2021 |
>147764
NLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIE
>m0xkA_310 weight: 1.0000 score: 5.01 eval: n/a prob: n/a identity: 0.1125 startpos: 12
HRLREPQLLEAIAHFLVvvVQKLVlgRLNYL---------PLefMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRA
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington