SSGCID - MygeA.10014.c Putative ABC transporter ATP-binding protein MG468.1 MG_526 Domain 1 Parse 1 Confidence: 0.48
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 10550 | Complete | Structure prediction | ssgcid | SSGCID - MygeA.10014.c Pu... | 284 | 4 Nov 2019 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 15802 | 1 | 1 | 0.48 | comparative modeling | 1-51 | 51 | 12 Feb 2020 |
>15802
MVLKTKENKKFDIYLKSSDFAVSKKASKLIKKLNKKHPKRKSLNSFEAKKY
>5oddA_201 weight: 1.0000 score: 20.57 eval: 63 prob: 42.53 identity: 0.1569 startpos: 48
-LEETRLGKLINDVRktKNEELAKRAKKLLRSWQKLIEPAHQHE-------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington