2022-01-29_00000279_1_19 Domain 6 Parse 1 Confidence: 0.10
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
200292 | Complete | Structure prediction | RoseTTAFold | 2022-01-29_00000279_1_19 | 1239 | 29 Jan 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
197273 | 6 | 1 | 0.10 | comparative modeling | 1162-1239 | 78 | 30 Jan 2022 |
>197273
GFSPSNKWDVSTAARMQQRRVISLMDDLMSESETFARSAHSNHSLLQQIRRSYVKARKRGDLHTVKALQLRLKGFFQI
>6z0cD_101 weight: 0.9699 score: 49.95 eval: 0.02 prob: n/a identity: 0.1282 startpos: 52
------------EKKSVLQKQLELEEKQIELLETLQQTAQEAQQLLQELQQTGQELWQLglRQKFQQLAQKIQQLLQK
>6z0cA_103 weight: 0.0301 score: 47.14 eval: 0.027 prob: n/a identity: 0.1282 startpos: 52
------------EKKSVLQKQLELEEKQIELLETLQQTAQEAQQLLQELQQTGQELWQLG--sGGPELRQKFQQLAQK
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington