T0953s1 Domain 1 Parse 1 Confidence: 0.06
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 142 | Complete | Structure prediction | casp | T0953s1 | 72 | 4 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 209 | 1 | 1 | 0.06 | comparative modeling | 1-72 | 72 | 4 May 2018 |
>209
GALGSASIAIGDNDTGLRWGGDGIVQIVANNAIVGGWNSTDIFTEAGKHITSNGNLNQWGGGAIYCRDLNVS
>4a7kA_110 weight: 1.0000 score: 24.83 eval: 0.0038 prob: n/a identity: 0.0417 startpos: 394
-----DIATISYSVPGYFESPNPSINVFLSTGILAERleVMLRVVRAGSTRFKTEMEFLDVAGKKLTLVVLP
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington