2022-03-26_00000099_1_11 Domain 1 Parse 1 Confidence: 0.18
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 264487 | Complete | Structure prediction | cameo | 2022-03-26_00000099_1_11 | 1179 | 26 Mar 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 260327 | 1 | 1 | 0.18 | comparative modeling | 1-42 | 42 | 26 Mar 2022 |
>260327
DEDQVDPRLIDGKWSRDQYHVLFDSYRDNIAGKSFQNRLCLP
>1neeA_101 weight: 1.0000 score: 11.95 eval: 0.018 prob: n/a identity: 0.0952 startpos: 77
-------AILQGKFTHFLINERIEDYVNK-------FVICHE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington