2022-04-09_00000151_1_11 Domain 1 Parse 1 Confidence: 0.06
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
272892 | Complete | Structure prediction | cameo | 2022-04-09_00000151_1_11 | 1172 | 9 Apr 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
268979 | 1 | 1 | 0.06 | comparative modeling | 1-99 | 99 | 10 Apr 2022 |
>268979
MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQ
>2e1dA_101 weight: 0.9749 score: 21.39 eval: 0.082 prob: n/a identity: 0.0505 startpos: 295
---------------------------------------------------EKLSDGIRKFadAIKLERMLTERMFS----------------------
>1f05A_105 weight: 0.0251 score: 20.6 eval: 0.095 prob: n/a identity: 0.0404 startpos: 296
---------------------------------------------------EKLSDGIRKFadAVKLERMLTERMFN----------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington