T1046s1 Domain 1 Parse 1 Confidence: 0.23
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 28402 | Complete | Structure prediction | casp | T1046s1 | 74 | 5 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 27824 | 1 | 1 | 0.23 | comparative modeling | 1-74 | 74 | 5 Jun 2020 |
>27824
MNVDPHFDKFMESGIRHVYMLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETE
>5kzaA_201 weight: 1.0000 score: 19.46 eval: 380 prob: 35.38 identity: 0.0946 startpos: 1
----SEFEAVIKvsACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGsiTAALSQRAMILGKSG----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington