T1070 Domain 1 Parse 1 Confidence: 0.04
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 31085 | Complete | Structure prediction | casp | T1070 | 335 | 29 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 30431 | 1 | 1 | 0.04 | comparative modeling | 1-79 | 79 | 30 Jun 2020 |
>30431
MANKPTQPLFPLGLETSESSNIKGFNNSGTIEHSPGAVMTFPEDTEVTGLPSSVRYNPDSDEFEGYYENGGWLSLGGGG
>6szcA_301 weight: 1.0000 score: 5.72 eval: n/a prob: n/a identity: 0.1899 startpos: 1
QGGDPLVPIDETVedGSKEKTIPGQ---GTYTIVPDGTVTFTPDKQFVGKPDPVTVkkNGTPVTATYSPEFTKV-----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington