T1070 Domain 3 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 31085 | Complete | Structure prediction | casp | T1070 | 335 | 29 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 30433 | 3 | 1 | 0.33 | comparative modeling | 178-262 | 85 | 30 Jun 2020 |
>30433
VGLGQGRVYSREIFTQILASETSAVTLNTPPTIVDVYADGKRLAESKYSLDGNVITFSPSLPASTELQVIEYTPIQLGNGGGSGS
>6c0bA_101 weight: 1.0000 score: 33.95 eval: 0.0016 prob: n/a identity: 0.1294 startpos: 201
-------VLISKVYMDDS-KPSFGYYSNN-LKDVKVITKdvNILTGYYLKDDIKISLSLTL---QDEKTIKLNSVHLDES-----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington