2022-09-10_00000002_2_11 Domain 9 Parse 1 Confidence: 0.93
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 409036 | Complete | Structure prediction | cameo | 2022-09-10_00000002_2_11 | 1817 | 10 Sep 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 404359 | 9 | 1 | 0.93 | comparative modeling | 1769-1817 | 49 | 11 Sep 2022 |
>404359
SDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
>2bztA_302 weight: 1.0000 score: 6.14 eval: n/a prob: n/a identity: 0.1837 startpos: 18
AYPDLDPKTVRFTDMHQWICDldDPQASNEKILEAILLVWLDEAE----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington