T0979 Domain 1 Parse 1 Confidence: 0.35
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 280 | Complete | Structure prediction | casp | T0979 | 98 | 31 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 421 | 1 | 1 | 0.35 | comparative modeling | 1-98 | 98 | 31 May 2018 |
>421
GGGSGMKQLEDKVEELLSKVYHLENEVARLKKLFAETATKAETATKAETATKKDIAGMATKHDIAQLDKRMKQLEWKVEELLSKVYHLENEVARLKKL
>1gjjA_w002 weight: 1.0000 score: 0.01904 eval: n/a prob: n/a identity: 0.0612 startpos: 4
----------FLEDPSVLTKDKLELVANNVTLPAGEQ-RKDVYVQLYLQHL-TARNR--DVTELTNEDLLDQLVKYTRKLYEKKLLREQG--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington