T0980s2 Domain 1 Parse 1 Confidence: 0.25
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 282 | Complete | Structure prediction | casp | T0980s2 | 52 | 1 Jun 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 423 | 1 | 1 | 0.25 | comparative modeling | 1-52 | 52 | 1 Jun 2018 |
>423
VNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK
>5gmka_304 weight: 1.0000 score: 6.32 eval: n/a prob: n/a identity: 0.1346 startpos: 4
VSQ-LNEKINMQRLRVNLFLLFanFKKQRGQAFITMRTIDQASLAQISLNGE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington