T0986s2 Domain 1 Parse 1 Confidence: 0.08
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 318 | Complete | Structure prediction | casp | T0986s2 | 155 | 8 Jun 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 474 | 1 | 1 | 0.08 | comparative modeling | 1-82 | 82 | 9 Jun 2018 |
>474
MKELFEVIFEGVNTSRLFFLLKEIESKSDRIFDFNFSEDFFSSNVNVFSELLIDSFLGFNGDLYFGVSMEGFSVKDGLKLPV
>2qy2A_201 weight: 1.0000 score: 21.48 eval: 470 prob: 23.39 identity: 0.1463 startpos: 25
-NLEFEVSFKNINYPNFMRITEHYINITPeyLDISLIFPDKNVYrsLFNQEQIGEFidPSDDIEIVYKNRGSGK---L-IGI
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington