2021-01-02_00000089_1_11 Domain 3 Parse 1 Confidence: 0.19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 50547 | Complete | Structure prediction | cameo | 2021-01-02_00000089_1_11 | 1612 | 2 Jan 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 49417 | 3 | 1 | 0.19 | comparative modeling | 1542-1612 | 71 | 3 Jan 2021 |
>49417
SPVTTTNNLPRRSMASARGNKLRTSLDRTREEMLANHQLDTRYSVERARASLDLPGINHAETLLSQRSRDR
>5gw9A_201 weight: 1.0000 score: 20.05 eval: 340 prob: 34.66 identity: 0.1408 startpos: 7
-------------KSLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPwlQ-LAGCLSQLHSG-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington