2023-04-22_00000083_1_19 Domain 5 Parse 1 Confidence: 0.32
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
509670 | Complete | Structure prediction | RoseTTAFold | 2023-04-22_00000083_1_19 | 1173 | 22 Apr 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
504629 | 5 | 1 | 0.32 | comparative modeling | 975-1039 | 65 | 22 Apr 2023 |
>504629
PYAPALTLKQLESITSKQELDKLTQSIPISLSKSDVKVIDYYNKIQKNYNLPAYNSTPMRKAYAV
>3ma8A_201 weight: 1.0000 score: 20 eval: n/a prob: 11.65 identity: 0.1385 startpos: 180
-HLPIIGDKDRHDidFALKYN--LDFIALSFVQNGADVQLCRQIISENTQY-SNGIPSSIKIIS-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington