2023-10-07_00000186_1_19 Domain 1 Parse 1 Confidence: 0.32
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 555634 | Complete | Structure prediction | RoseTTAFold | 2023-10-07_00000186_1_19 | 1337 | 7 Oct 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 550444 | 1 | 1 | 0.32 | comparative modeling | 1-93 | 93 | 7 Oct 2023 |
>550444
MEHRYNVFNDTPRGNHWMGSSVSGSPRPSYSSRPNVNTTRRFQYSDDEPAEKIRPLRSRSFKSTESNISDEKSRISERDSKDRYINGDKKVDI
>6em3e_301 weight: 1.0000 score: 7.91 eval: n/a prob: n/a identity: 0.1075 startpos: 25
VAENWRKQKGIDSVVRRRFRGNISQPKIGYGSNKKTKFlkTFLVANVKDLETLTMHTKTYAAEIAHNISAKNRVVILARAKakVTNPKGRLAL
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington