2023-10-07_00000186_1_19 Domain 3 Parse 1 Confidence: 0.01
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
555634 | Complete | Structure prediction | RoseTTAFold | 2023-10-07_00000186_1_19 | 1337 | 7 Oct 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
550446 | 3 | 1 | 0.01 | comparative modeling | 247-335 | 89 | 7 Oct 2023 |
>550446
ENTAMFNPLHESYCLPMDTNLFKINSIDVPIRINSTEEIEYIELEYRDLYTNSVELRSLSKKDFKIIDNPKSFLKKDQSVLKSHSNDFE
>6d6vF_301 weight: 1.0000 score: 6.61 eval: n/a prob: n/a identity: 0.0899 startpos: 3
VMYPRILffrkKVTvnVCNEDQNDSLVIEfvVIDNYRRvkFVEIRGVV--LNQNIVSCEELTEFE-QKDPFDFDTYSKLIHLSQSDKLS
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington