2023-10-07_00000186_1_19 Domain 4 Parse 1 Confidence: 0.79
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 555634 | Complete | Structure prediction | RoseTTAFold | 2023-10-07_00000186_1_19 | 1337 | 7 Oct 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 550447 | 4 | 1 | 0.79 | comparative modeling | 329-442 | 114 | 7 Oct 2023 |
>550447
SHSNDFEEGSTIRYLAVTLQDIGFYQIKKIVDSKKLNLKIHQSHLVVPYCPIASITGTGSNDRCIGDSDNVSFEIQGVPPMKLAYSKIVNGQTFSYVDSSLQPEYFESPLQSSK
>4opwA_103 weight: 1.0000 score: 41.7 eval: 0.0022 prob: n/a identity: 0.0877 startpos: 127
----------EVGKLDLNVSGSANMVVNELKT-DKLECSInsGTINLK-aEEADYSITT----------DGEIMAFGVAVPEVNCKITGKGSAQIHPTDNLKATI---------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington