2023-10-07_00000186_1_19 Domain 7 Parse 1 Confidence: 0.76
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
555634 | Complete | Structure prediction | RoseTTAFold | 2023-10-07_00000186_1_19 | 1337 | 7 Oct 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
550450 | 7 | 1 | 0.76 | comparative modeling | 1148-1230 | 83 | 7 Oct 2023 |
>550450
KIHILDPSTEYCVGDYVAYQLNGVAPFMIKYEFNGIPLKSKERSSQFVRLASEPGIISITSLQDSSSQCIVDFTNPKLKSEFD
>5t7aA_303 weight: 1.0000 score: 7.2 eval: n/a prob: n/a identity: 0.0964 startpos: 1
-NGDSHTHPDYTAGIriFFAPTTEARydVHLKVNnlNYRMTERNGEWERVVesSgvLEYSFTYEKLGP-QYTTEWFTYSR---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington