2023-10-28_00000211_2_19 Domain 2 Parse 1 Confidence: 0.34
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 558331 | Complete | Structure prediction | RoseTTAFold | 2023-10-28_00000211_2_19 | 1444 | 28 Oct 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 553155 | 2 | 1 | 0.34 | comparative modeling | 1374-1444 | 71 | 28 Oct 2023 |
>553155
TIGIPMHRNKKALQAGFDLSNKKVDVLTKAVGSVFKEIINRTGISNAPKKLKQATPTKPTPKTPPKPPVKQ
>m127A_201 weight: 1.0000 score: 21.61 eval: 150 prob: 40.78 identity: 0.1408 startpos: 14
-------QITRMEAAVNNDPSLAIGTAKELIESCCKTILAERGVadVPKLVKATVKEllTPSD--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington