2021-03-07_00000039_2_11 Domain 4 Parse 1 Confidence: 0.10
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 60931 | Complete | Structure prediction | cameo | 2021-03-07_00000039_2_11 | 1473 | 7 Mar 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 59378 | 4 | 1 | 0.10 | comparative modeling | 1014-1086 | 73 | 8 Mar 2021 |
>59378
RLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPEVVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPV
>4r3uC_101 weight: 1.0000 score: 20.94 eval: 0.017 prob: n/a identity: 0.0685 startpos: 40
HRTPEEVVNTAIQEDVDVLGVSLL-------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington