2021-03-07_00000039_2_11 Domain 6 Parse 1 Confidence: 0.16
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 60931 | Complete | Structure prediction | cameo | 2021-03-07_00000039_2_11 | 1473 | 7 Mar 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 59380 | 6 | 1 | 0.16 | comparative modeling | 1315-1377 | 63 | 8 Mar 2021 |
>59380
GEDQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQ
>6ah0i_301 weight: 0.9796 score: 5.72 eval: n/a prob: n/a identity: 0.0952 startpos: 5
KMLQHIDYRMRCILQDGrtFKAFDKHMNLILCDCDEFREKRVLGLVLLRGevSMTVEGPPPKD
>5zwmb_310 weight: 0.0204 score: 4.9 eval: n/a prob: n/a identity: 0.1270 startpos: 6
FLKKLRNEQVTIELKNGttLQSVSPQMNAILTDVKLTLQQPTASD-NIANTIRQIILPDSLNL
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington