2024-03-09_00000226_1_19 Domain 2 Parse 1 Confidence: 0.41
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 601020 | Complete | Structure prediction | RoseTTAFold | 2024-03-09_00000226_1_19 | 1937 | 9 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 595338 | 2 | 1 | 0.41 | comparative modeling | 1511-1553 | 43 | 10 Mar 2024 |
>595338
KFTAEHWAKIVGAFCELFERTTAYQLFSATTINSTASLSPPPS
>6c02A_w012 weight: 0.5255 score: 0.13402 eval: n/a prob: n/a identity: 0.0233 startpos: 2
SCRKKCFSFRGLENCRCDVACKDRGDCCWDFEDTCVEST----
>6c01A_w010 weight: 0.4745 score: 0.10931 eval: n/a prob: n/a identity: 0.0233 startpos: 1
SCRKKCFSFRGLENCRCDVACKDRGDCCWDFEDTCVEST----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington